SCOPe 2.05: Domain d2bnsb_: 2bns B:

Lineage for d2bnsb_ (2bns B:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (7 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)

8. Domain d2bnsb_: 2bns B: [128856]
   Other proteins in same PDB: d2bnsc1, d2bnsc2
   automated match to d1ystm_
   complexed with bcl, bph, cl, fe2, mst, po4, u10

Details for d2bnsb_

PDB Entry: 2bns, 2.5 Å

PDB Description: lipidic cubic phase grown reaction centre from rhodobacter sphaeroides, excited state

PDB Compounds: (B:) reaction centre protein m chain

SCOPe Domain Sequences for d2bnsb_:

Sequence; same for both SEQRES and ATOM records:

>d2bnsb_ f.26.1.1 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d2bnsb_:

• d2bnsb_ first appeared in SCOP 1.73, called d2bnsb1
  
• d2bnsb_ appears in SCOPe 2.04
  
• d2bnsb_ appears in SCOPe 2.06
  
• d2bnsb_ appears in the current release, SCOPe 2.08