Lineage for d2bnsa_ (2bns A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958788Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1958789Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1958790Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1958970Protein automated matches [190224] (7 species)
    not a true protein
  7. 1958986Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)
  8. 1959022Domain d2bnsa_: 2bns A: [128855]
    Other proteins in same PDB: d2bnsc1, d2bnsc2
    automated match to d1aigl_
    complexed with bcl, bph, cl, fe2, mst, po4, u10

Details for d2bnsa_

PDB Entry: 2bns (more details), 2.5 Å

PDB Description: lipidic cubic phase grown reaction centre from rhodobacter sphaeroides, excited state
PDB Compounds: (A:) reaction centre protein l chain

SCOPe Domain Sequences for d2bnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnsa_ f.26.1.1 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d2bnsa_:

Click to download the PDB-style file with coordinates for d2bnsa_.
(The format of our PDB-style files is described here.)

Timeline for d2bnsa_: