SCOPe 2.03: Domain d2bgnf1: 2bgn F:4-355

Lineage for d2bgnf1 (2bgn F:4-355)

Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
Protein Adenosine deaminase (ADA) [51558] (4 species)
Common fold covers the whole protein structure
Species Cow (Bos taurus) [TaxId:9913] [82257] (12 PDB entries)
Uniprot P56658 3-350 ! Uniprot P56658
Domain d2bgnf1: 2bgn F:4-355 [128493]
Other proteins in same PDB: d2bgna1, d2bgna2, d2bgnb1, d2bgnb2, d2bgnc1, d2bgnc2, d2bgnd1, d2bgnd2
automatically matched to d1w1ie_
complexed with nag, zn

Details for d2bgnf1

PDB Entry: 2bgn (more details), 3.15 Å

PDB Description: hiv-1 tat protein derived n-terminal nonapeptide trp2-tat(1-9) bound to the active site of dipeptidyl peptidase iv (cd26)

PDB Compounds: (F:) adenosine deaminase

SCOPe Domain Sequences for d2bgnf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgnf1 c.1.9.1 (F:4-355) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps

SCOPe Domain Coordinates for d2bgnf1:

Click to download the PDB-style file with coordinates for d2bgnf1.
(The format of our PDB-style files is described here.)

Timeline for d2bgnf1: