Lineage for d2bgnc1 (2bgn C:39-508)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327543Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 1327637Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 1327638Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 1327645Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 1327646Species Human (Homo sapiens) [TaxId:9606] [82174] (68 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 1327804Domain d2bgnc1: 2bgn C:39-508 [128488]
    Other proteins in same PDB: d2bgna2, d2bgnb2, d2bgnc2, d2bgnd2, d2bgne1, d2bgnf1, d2bgng1, d2bgnh1
    automatically matched to d1orva1
    complexed with nag, zn

Details for d2bgnc1

PDB Entry: 2bgn (more details), 3.15 Å

PDB Description: hiv-1 tat protein derived n-terminal nonapeptide trp2-tat(1-9) bound to the active site of dipeptidyl peptidase iv (cd26)
PDB Compounds: (C:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2bgnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgnc1 b.70.3.1 (C:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d2bgnc1:

Click to download the PDB-style file with coordinates for d2bgnc1.
(The format of our PDB-style files is described here.)

Timeline for d2bgnc1: