Lineage for d2b9ok1 (2b9o K:11-129)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 837367Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 837368Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 837458Protein Ribosomal protein S11 [53141] (2 species)
  7. 837484Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
    Uniprot P80376
  8. 837529Domain d2b9ok1: 2b9o K:11-129 [128173]
    Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1
    automatically matched to d1i94k_
    complexed with psu, yyg

Details for d2b9ok1

PDB Entry: 2b9o (more details), 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOP Domain Sequences for d2b9ok1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9ok1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOP Domain Coordinates for d2b9ok1:

Click to download the PDB-style file with coordinates for d2b9ok1.
(The format of our PDB-style files is described here.)

Timeline for d2b9ok1: