![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
![]() | Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
![]() | Protein Ribosomal protein S18 [46913] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
![]() | Domain d2b9or1: 2b9o R:16-88 [128180] Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9os1, d2b9ot1, d2b9ou1 automatically matched to d1i94r_ complexed with psu, yyg |
PDB Entry: 2b9o (more details), 6.46 Å
SCOP Domain Sequences for d2b9or1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9or1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d2b9or1: