Class g: Small proteins [56992] (90 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) |
Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
Protein Ribosomal protein S14 [57753] (2 species) |
Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries) Uniprot P24320 |
Domain d2b9on1: 2b9o N:2-61 [128176] Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1 automatically matched to d1fjgn_ complexed with psu, yyg |
PDB Entry: 2b9o (more details), 6.46 Å
SCOP Domain Sequences for d2b9on1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9on1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d2b9on1: