![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
![]() | Domain d2b9ob1: 2b9o B:7-240 [128162] Other proteins in same PDB: d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1 automatically matched to d1i94b_ complexed with psu, yyg |
PDB Entry: 2b9o (more details), 6.46 Å
SCOP Domain Sequences for d2b9ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9ob1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d2b9ob1: