Lineage for d2b9nt1 (2b9n T:4-56)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065411Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1065412Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1065697Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 1065698Protein Ribosomal protein L24e [57750] (1 species)
  7. 1065699Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 1065743Domain d2b9nt1: 2b9n T:4-56 [128158]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1
    automatically matched to d1ffkr_

Details for d2b9nt1

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (T:) 50S ribosomal protein L19

SCOPe Domain Sequences for d2b9nt1:

Sequence, based on SEQRES records: (download)

>d2b9nt1 g.39.1.6 (T:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Sequence, based on observed residues (ATOM records): (download)

>d2b9nt1 g.39.1.6 (T:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlrearnlewtdtar

SCOPe Domain Coordinates for d2b9nt1:

Click to download the PDB-style file with coordinates for d2b9nt1.
(The format of our PDB-style files is described here.)

Timeline for d2b9nt1: