Lineage for d2b9nr1 (2b9n R:14-118)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050126Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 1050127Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
  5. 1050128Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 1050129Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 1050167Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 1050186Domain d2b9nr1: 2b9n R:14-118 [128157]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1
    automatically matched to d1gd8a_

Details for d2b9nr1

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (R:) 50S ribosomal protein L17

SCOPe Domain Sequences for d2b9nr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9nr1 d.188.1.1 (R:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOPe Domain Coordinates for d2b9nr1:

Click to download the PDB-style file with coordinates for d2b9nr1.
(The format of our PDB-style files is described here.)

Timeline for d2b9nr1: