Lineage for d2b66r1 (2b66 R:14-118)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1228415Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 1228416Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
  5. 1228417Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 1228418Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 1228456Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 1228473Domain d2b66r1: 2b66 R:14-118 [127965]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1
    automatically matched to d1gd8a_

Details for d2b66r1

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (R:) 50S ribosomal protein L17

SCOPe Domain Sequences for d2b66r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b66r1 d.188.1.1 (R:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOPe Domain Coordinates for d2b66r1:

Click to download the PDB-style file with coordinates for d2b66r1.
(The format of our PDB-style files is described here.)

Timeline for d2b66r1: