Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) |
Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries) Uniprot P60488 1-139 |
Domain d2b66n1: 2b66 N:4-141 [127963] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 automatically matched to d1ffkg_ |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b66n1:
Sequence, based on SEQRES records: (download)
>d2b66n1 c.21.1.1 (N:4-141) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]} aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr lsnikfvtlgeisetlga
>d2b66n1 c.21.1.1 (N:4-141) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]} aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi gndngyfypkrpdgifkrtirgmlpkkqrgreafesvrvylgnpydtlgeisetlga
Timeline for d2b66n1: