SCOPe 2.08: Domain d2aw6b2: 2aw6 B:67-286

Lineage for d2aw6b2 (2aw6 B:67-286)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)

6. Protein automated matches [254479] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)

8. Domain d2aw6b2: 2aw6 B:67-286 [127411]
   Other proteins in same PDB: d2aw6a1, d2aw6a2, d2aw6b1
   automated match to d2awia2
   protein/DNA complex

Details for d2aw6b2

PDB Entry: 2aw6, 3 Å

PDB Description: structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation

PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2aw6b2:

Sequence; same for both SEQRES and ATOM records:

>d2aw6b2 a.118.8.4 (B:67-286) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisak

Timeline for d2aw6b2:

• d2aw6b2 first appeared in SCOP 1.73
  
• d2aw6b2 appears in SCOPe 2.07