Lineage for d2aslb1 (2asl B:1241-1341)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008408Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 3008409Protein DinB homolog (DBH) [100881] (3 species)
  7. 3008418Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)
  8. 3008461Domain d2aslb1: 2asl B:1241-1341 [127260]
    Other proteins in same PDB: d2asla2, d2asla3, d2aslb2, d2aslb3
    automated match to d1jx4a1
    protein/DNA complex; complexed with ca

Details for d2aslb1

PDB Entry: 2asl (more details), 2.65 Å

PDB Description: oxoG-modified Postinsertion Binary Complex
PDB Compounds: (B:) DNA polymerase IV

SCOPe Domain Sequences for d2aslb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aslb1 d.240.1.1 (B:1241-1341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOPe Domain Coordinates for d2aslb1:

Click to download the PDB-style file with coordinates for d2aslb1.
(The format of our PDB-style files is described here.)

Timeline for d2aslb1: