Lineage for d2arof_ (2aro F:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082716Protein Histone H2B [47119] (6 species)
  7. 1082792Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (6 PDB entries)
    Uniprot P02279
  8. 1082796Domain d2arof_: 2aro F: [127214]
    Other proteins in same PDB: d2aroa_, d2aroc_, d2arod_, d2aroe_, d2arog_, d2aroh_
    automated match to d1kx5d_
    complexed with cl, po4

Details for d2arof_

PDB Entry: 2aro (more details), 2.1 Å

PDB Description: Crystal Structure Of The Native Histone Octamer To 2.1 Angstrom Resolution, Crystalised In The Presence Of S-Nitrosoglutathione
PDB Compounds: (F:) histone h2b

SCOPe Domain Sequences for d2arof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arof_ a.22.1.1 (F:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytssk

SCOPe Domain Coordinates for d2arof_:

Click to download the PDB-style file with coordinates for d2arof_.
(The format of our PDB-style files is described here.)

Timeline for d2arof_: