SCOPe 2.06: Domain d2apob_: 2apo B:

Lineage for d2apob_ (2apo B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)
   automatically mapped to Pfam PF04135

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)

6. Protein Ribosome biogenesis protein Nop10 [144214] (2 species)

7. Species Methanococcus jannaschii [TaxId:2190] [144216] (2 PDB entries)
   Uniprot P81303 1-60

8. Domain d2apob_: 2apo B: [127135]
   Other proteins in same PDB: d2apoa1, d2apoa2
   automated match to d2aqca1
   protein/RNA complex; complexed with k, zn

Details for d2apob_

PDB Entry: 2apo, 1.95 Å

PDB Description: Crystal Structure of the Methanococcus jannaschii Cbf5 Nop10 Complex

PDB Compounds: (B:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2apob_:

Sequence; same for both SEQRES and ATOM records:

>d2apob_ g.41.16.1 (B:) Ribosome biogenesis protein Nop10 {Methanococcus jannaschii [TaxId: 2190]}
emrmkkcpkcglytlkeicpkcgektvipkppkfsledrwgkyrrmlkralknkn

Timeline for d2apob_:

• d2apob_ first appeared in SCOP 1.73, called d2apob1
  
• d2apob_ appears in SCOPe 2.05
  
• d2apob_ appears in SCOPe 2.07
  
• d2apob_ appears in the current release, SCOPe 2.08