SCOP 1.73: Domain d2apob1: 2apo B:403-457

Lineage for d2apob1 (2apo B:403-457)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (2 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)

6. Protein Ribosome biogenesis protein Nop10 [144214] (2 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [144216] (2 PDB entries)

8. Domain d2apob1: 2apo B:403-457 [127135]
   Other proteins in same PDB: d2apoa1, d2apoa2
   automatically matched to 2AQC A:1-60
   complexed with k, zn

Details for d2apob1

PDB Entry: 2apo, 1.95 Å

PDB Description: Crystal Structure of the Methanococcus jannaschii Cbf5 Nop10 Complex

PDB Compounds: (B:) Ribosome biogenesis protein Nop10

SCOP Domain Sequences for d2apob1:

Sequence; same for both SEQRES and ATOM records:

>d2apob1 g.41.16.1 (B:403-457) Ribosome biogenesis protein Nop10 {Archaeon Methanococcus jannaschii [TaxId: 2190]}
emrmkkcpkcglytlkeicpkcgektvipkppkfsledrwgkyrrmlkralknkn

Timeline for d2apob1:

• d2apob1 is new in SCOP 1.73
  
• d2apob1 appears in SCOP 1.75
  
• d2apob1 appears in the current release, SCOPe 2.08, called d2apob_