SCOPe 2.08: Domain d2ahvc2: 2ahv C:4-276

Lineage for d2ahvc2 (2ahv C:4-276)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins)
   parallel beta-sheet of 7 strands, order 4321567

6. Protein Putative enzyme YdiF N-terminal domain [142198] (1 species)

7. Species Escherichia coli [TaxId:562] [142199] (3 PDB entries)
   Uniprot P37766 4-276

8. Domain d2ahvc2: 2ahv C:4-276 [126798]
   Other proteins in same PDB: d2ahva1, d2ahvb1, d2ahvc1, d2ahvd1
   automated match to d2ahua2
   complexed with coa

Details for d2ahvc2

PDB Entry: 2ahv, 2 Å

PDB Description: Crystal Structure of Acyl-CoA transferase from E. coli O157:H7 (YdiF)-thioester complex with CoA- 1

PDB Compounds: (C:) putative enzyme YdiF

SCOPe Domain Sequences for d2ahvc2:

Sequence; same for both SEQRES and ATOM records:

>d2ahvc2 c.124.1.2 (C:4-276) Putative enzyme YdiF N-terminal domain {Escherichia coli [TaxId: 562]}
vkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtprnl
siisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgvltq
tlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaiapdi
afirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksvrip
gylvdivvvdpdqsqlyggapvnrfisgdftld

Timeline for d2ahvc2:

• d2ahvc2 first appeared in SCOP 1.73
  
• d2ahvc2 appears in SCOPe 2.07