Lineage for d2ahvc2 (2ahv C:4-276)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713168Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 713169Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (7 families) (S)
  5. 713200Family c.124.1.2: CoA transferase alpha subunit-like [74656] (6 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 713221Protein Putative enzyme YdiF N-terminal domain [142198] (1 species)
  7. 713222Species Escherichia coli [TaxId:562] [142199] (3 PDB entries)
  8. 713229Domain d2ahvc2: 2ahv C:4-276 [126798]
    Other proteins in same PDB: d2ahva1, d2ahvb1, d2ahvc1, d2ahvd1
    automatically matched to 2AHU A:4-276
    complexed with coa

Details for d2ahvc2

PDB Entry: 2ahv (more details), 2 Å

PDB Description: Crystal Structure of Acyl-CoA transferase from E. coli O157:H7 (YdiF)-thioester complex with CoA- 1
PDB Compounds: (C:) putative enzyme YdiF

SCOP Domain Sequences for d2ahvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahvc2 c.124.1.2 (C:4-276) Putative enzyme YdiF N-terminal domain {Escherichia coli [TaxId: 562]}
vkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtprnl
siisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgvltq
tlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaiapdi
afirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksvrip
gylvdivvvdpdqsqlyggapvnrfisgdftld

SCOP Domain Coordinates for d2ahvc2:

Click to download the PDB-style file with coordinates for d2ahvc2.
(The format of our PDB-style files is described here.)

Timeline for d2ahvc2: