SCOPe 2.05: Domain d2abqb_: 2abq B:

Lineage for d2abqb_ (2abq B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
   automatically mapped to Pfam PF00294

6. Protein automated matches [190470] (2 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:86665] [187390] (1 PDB entry)

8. Domain d2abqb_: 2abq B: [126529]
   Other proteins in same PDB: d2abqa1
   automated match to d2abqa1
   complexed with po4

Details for d2abqb_

PDB Entry: 2abq, 2.1 Å

PDB Description: crystal structure of fructose-1-phosphate kinase from bacillus halodurans

PDB Compounds: (B:) fructose 1-phosphate kinase

SCOPe Domain Sequences for d2abqb_:

Sequence; same for both SEQRES and ATOM records:

>d2abqb_ c.72.1.1 (B:) automated matches {Bacillus halodurans [TaxId: 86665]}
miytvtlnpsidyivqvenfqqgvvnrserdrkqpggkginvsrvlkrlghetkalgflg
gftgayvrnalekeeiglsfievegdtrinvkikgkqetelngtaplikkehvqalleql
telekgdvlvlagsvpqampqtiyrsmtqiakergafvavdtsgealhevlaakpsfikp
nhhelselvskpiasiedaiphvqrligegiesilvsfagdgalfasaegmfhvnvpsge
vrnsvgagdsvvagflaalqegksledavpfavaagsatafsdgfctreeverlqqqlqr
tikkeg

Timeline for d2abqb_:

• d2abqb_ first appeared in SCOP 1.73, called d2abqb1
  
• d2abqb_ appears in SCOPe 2.04
  
• d2abqb_ appears in SCOPe 2.06
  
• d2abqb_ appears in the current release, SCOPe 2.08