SCOPe 2.02: Domain d2a94a1: 2a94 A:18-163

Lineage for d2a94a1 (2a94 A:18-163)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Lactate dehydrogenase [51859] (14 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (15 PDB entries)

8. Domain d2a94a1: 2a94 A:18-163 [126423]
   Other proteins in same PDB: d2a94a2
   automatically matched to d1oc4a1
   complexed with ap0

Details for d2a94a1

PDB Entry: 2a94, 1.5 Å

PDB Description: structure of plasmodium falciparum lactate dehydrogenase complexed to apadh.

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2a94a1:

Sequence; same for both SEQRES and ATOM records:

>d2a94a1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiigl

Timeline for d2a94a1:

• d2a94a1 first appeared in SCOP 1.73
  
• d2a94a1 appears in SCOPe 2.01
  
• d2a94a1 appears in SCOPe 2.03
  
• d2a94a1 appears in the current release, SCOPe 2.08