Class b: All beta proteins [48724] (174 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein Trypanosoma sialidase [82164] (2 species) |
Species Trypanosoma rangeli [TaxId:5698] [82165] (10 PDB entries) Uniprot O44049 20-653 |
Domain d2a75a2: 2a75 A:-1-403 [126327] Other proteins in same PDB: d2a75a1 automatically matched to d1n1sa2 complexed with fsi, so4 |
PDB Entry: 2a75 (more details), 1.95 Å
SCOPe Domain Sequences for d2a75a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a75a2 b.68.1.1 (A:-1-403) Trypanosoma sialidase {Trypanosoma rangeli [TaxId: 5698]} aslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryets fdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktr nswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefig gvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewe gkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegk rvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhe intndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpa
Timeline for d2a75a2: