SCOP 1.75: Domain d2a75a2: 2a75 A:-1-403

Lineage for d2a75a2 (2a75 A:-1-403)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (2 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)

6. Protein Trypanosoma sialidase [82164] (2 species)

7. Species Trypanosoma rangeli [TaxId:5698] [82165] (10 PDB entries)
   Uniprot O44049 20-653

8. Domain d2a75a2: 2a75 A:-1-403 [126327]
   Other proteins in same PDB: d2a75a1
   automatically matched to d1n1sa2
   complexed with fsi, so4

Details for d2a75a2

PDB Entry: 2a75, 1.95 Å

PDB Description: trypanosoma rangeli sialidase in complex with 2,3- difluorosialic acid (covalent intermediate)

PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d2a75a2:

Sequence; same for both SEQRES and ATOM records:

>d2a75a2 b.68.1.1 (A:-1-403) Trypanosoma sialidase {Trypanosoma rangeli [TaxId: 5698]}
aslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryets
fdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktr
nswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefig
gvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewe
gkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegk
rvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhe
intndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpa

Timeline for d2a75a2:

• d2a75a2 first appeared in SCOP 1.73
  
• d2a75a2 appears in SCOPe 2.01
  
• d2a75a2 appears in the current release, SCOPe 2.08