Lineage for d2a06n2 (2a06 N:234-443)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049845Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1049846Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1049847Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1049848Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 1049877Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries)
    Uniprot P31800
  8. 1049881Domain d2a06n2: 2a06 N:234-443 [125929]
    Other proteins in same PDB: d2a06b1, d2a06b2, d2a06d1, d2a06d2, d2a06f1, d2a06g_, d2a06h_, d2a06j_, d2a06o1, d2a06o2, d2a06q1, d2a06q2, d2a06s1, d2a06t_, d2a06u_, d2a06w_
    automatically matched to d1be3a2
    complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06n2

PDB Entry: 2a06 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (N:) Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial

SCOPe Domain Sequences for d2a06n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a06n2 d.185.1.1 (N:234-443) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmfw

SCOPe Domain Coordinates for d2a06n2:

Click to download the PDB-style file with coordinates for d2a06n2.
(The format of our PDB-style files is described here.)

Timeline for d2a06n2: