SCOP 1.73: Domain d2a06n2: 2a06 N:234-443

Lineage for d2a06n2 (2a06 N:234-443)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries)

8. Domain d2a06n2: 2a06 N:234-443 [125929]
   Other proteins in same PDB: d2a06b1, d2a06b2, d2a06d1, d2a06d2, d2a06f1, d2a06g1, d2a06h1, d2a06o1, d2a06o2, d2a06q1, d2a06q2, d2a06s1, d2a06t1, d2a06u1, d2a06w1
   automatically matched to d1be3a2
   complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06n2

PDB Entry: 2a06, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

PDB Compounds: (N:) Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial

SCOP Domain Sequences for d2a06n2:

Sequence; same for both SEQRES and ATOM records:

>d2a06n2 d.185.1.1 (N:234-443) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmfw

Timeline for d2a06n2:

• d2a06n2 is new in SCOP 1.73
  
• d2a06n2 appears in SCOP 1.75
  
• d2a06n2 appears in the current release, SCOPe 2.08