Lineage for d1zyrb1 (1zyr B:1-49,B:173-229)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656918Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1657041Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 1657042Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1657043Protein RNA polymerase alpha [55259] (3 species)
  7. 1657058Species Thermus thermophilus [TaxId:274] [75478] (14 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1657106Domain d1zyrb1: 1zyr B:1-49,B:173-229 [125851]
    Other proteins in same PDB: d1zyra2, d1zyrb2, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk2, d1zyrl2, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp1, d1zyrp2, d1zyrp3
    automatically matched to d1iw7a1
    protein/RNA complex; complexed with mg, std, zn

Details for d1zyrb1

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1zyrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyrb1 d.74.3.1 (B:1-49,B:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d1zyrb1:

Click to download the PDB-style file with coordinates for d1zyrb1.
(The format of our PDB-style files is described here.)

Timeline for d1zyrb1: