![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
![]() | Protein RNA polymerase alpha [55259] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [75478] (14 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
![]() | Domain d1zyrk1: 1zyr K:1-49,K:173-229 [125859] Other proteins in same PDB: d1zyra2, d1zyrb2, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk2, d1zyrl2, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp1, d1zyrp2, d1zyrp3 automatically matched to d1iw7a1 protein/RNA complex; complexed with mg, std, zn |
PDB Entry: 1zyr (more details), 3 Å
SCOPe Domain Sequences for d1zyrk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zyrk1 d.74.3.1 (K:1-49,K:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]} mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d1zyrk1: