Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.74: DCoH-like [55247] (4 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) form homo and heterodimers |
Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
Protein RNA polymerase alpha [55259] (3 species) |
Species Thermus thermophilus [TaxId:274] [75478] (9 PDB entries) |
Domain d1zyrb1: 1zyr B:1-49,B:173-229 [125851] Other proteins in same PDB: d1zyra2, d1zyrb2, d1zyrc1, d1zyrd1, d1zyre1, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk2, d1zyrl2, d1zyrm1, d1zyrn1, d1zyro1, d1zyrp1, d1zyrp2, d1zyrp3 automatically matched to d1iw7a1 complexed with mg, std, zn |
PDB Entry: 1zyr (more details), 3 Å
SCOP Domain Sequences for d1zyrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zyrb1 d.74.3.1 (B:1-49,B:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]} mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d1zyrb1: