Lineage for d1zujd1 (1zuj D:6-173)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766238Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 766392Species Lactococcus lactis, DpsA [TaxId:1358] [140434] (1 PDB entry)
    Uniprot A2RLG8 6-173
  8. 766396Domain d1zujd1: 1zuj D:6-173 [125675]
    automatically matched to 1ZUJ A:6-173

Details for d1zujd1

PDB Entry: 1zuj (more details), 2.9 Å

PDB Description: The crystal structure of the Lactococcus lactis MG1363 DpsA protein
PDB Compounds: (D:) hypothetical protein Llacc01001955

SCOP Domain Sequences for d1zujd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zujd1 a.25.1.1 (D:6-173) Dodecameric ferritin homolog {Lactococcus lactis, DpsA [TaxId: 1358]}
sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia
lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq
nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef

SCOP Domain Coordinates for d1zujd1:

Click to download the PDB-style file with coordinates for d1zujd1.
(The format of our PDB-style files is described here.)

Timeline for d1zujd1: