SCOP 1.75: Domain d1zujc1: 1zuj C:6-173

Lineage for d1zujc1 (1zuj C:6-173)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (9 proteins)

6. Protein Dodecameric ferritin homolog [47250] (13 species)

7. Species Lactococcus lactis, DpsA [TaxId:1358] [140434] (1 PDB entry)
   Uniprot A2RLG8 6-173

8. Domain d1zujc1: 1zuj C:6-173 [125674]
   automatically matched to 1ZUJ A:6-173

Details for d1zujc1

PDB Entry: 1zuj, 2.9 Å

PDB Description: The crystal structure of the Lactococcus lactis MG1363 DpsA protein

PDB Compounds: (C:) hypothetical protein Llacc01001955

SCOP Domain Sequences for d1zujc1:

Sequence; same for both SEQRES and ATOM records:

>d1zujc1 a.25.1.1 (C:6-173) Dodecameric ferritin homolog {Lactococcus lactis, DpsA [TaxId: 1358]}
sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia
lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq
nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef

Timeline for d1zujc1:

• d1zujc1 first appeared in SCOP 1.73
  
• d1zujc1 is called d1zujc_ in SCOPe 2.01
  
• d1zujc1 appears in the current release, SCOPe 2.08, called d1zujc_