Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Lactococcus lactis, DpsA [TaxId:1358] [140434] (1 PDB entry) |
Domain d1zujd1: 1zuj D:6-173 [125675] automatically matched to 1ZUJ A:6-173 |
PDB Entry: 1zuj (more details), 2.9 Å
SCOP Domain Sequences for d1zujd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zujd1 a.25.1.1 (D:6-173) Dodecameric ferritin homolog {Lactococcus lactis, DpsA [TaxId: 1358]} sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef
Timeline for d1zujd1: