Lineage for d1zplb_ (1zpl B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767770Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
    automatically mapped to Pfam PF09222
  6. 2767771Protein Fimbrial adhesin F17-AG lectin domain [89216] (1 species)
  7. 2767772Species Escherichia coli [TaxId:562] [89217] (7 PDB entries)
  8. 2767776Domain d1zplb_: 1zpl B: [125468]
    automated match to d1o9za_
    complexed with mag

Details for d1zplb_

PDB Entry: 1zpl (more details), 1.7 Å

PDB Description: e. coli f17a-g lectin domain complex with glcnac(beta1-o)me
PDB Compounds: (B:) F17a-G

SCOPe Domain Sequences for d1zplb_:

Sequence, based on SEQRES records: (download)

>d1zplb_ b.2.3.5 (B:) Fimbrial adhesin F17-AG lectin domain {Escherichia coli [TaxId: 562]}
avsfigstendvgpslgsysrthamdnlpfvydtrnkigyqnanvwhiskgfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtkysrgtamsgnswenvfsgwcvgantastqg
lsvrvtpvilkrnssarysvqktsigsirmrpyngssagsvqttvnfslnpftlnd

Sequence, based on observed residues (ATOM records): (download)

>d1zplb_ b.2.3.5 (B:) Fimbrial adhesin F17-AG lectin domain {Escherichia coli [TaxId: 562]}
avsfigstendvgpslgsysrnlpfvytrnkigyqnanvwhiskgfcvgldgkvdlpvvg
sldgqsiyglteevglliwmgdtkysrgtamsgnswenvfsgwcvgantastqglsvrvt
pvilkrnarysvqktsigsirmrpyngssagsvqttvnfslnpftlnd

SCOPe Domain Coordinates for d1zplb_:

Click to download the PDB-style file with coordinates for d1zplb_.
(The format of our PDB-style files is described here.)

Timeline for d1zplb_: