Lineage for d1znza_ (1znz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866327Species Mycobacterium tuberculosis [TaxId:1773] [186809] (11 PDB entries)
  8. 2866331Domain d1znza_: 1znz A: [125415]
    automated match to d1s4qa_
    complexed with gdp

Details for d1znza_

PDB Entry: 1znz (more details), 2.5 Å

PDB Description: Crystal Structure Of The Reduced Form Of Mycobacterium tuberculosis Guanylate Kinase In Complex With GDP
PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d1znza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1znza_ c.37.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq
lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf
lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl
lvg

SCOPe Domain Coordinates for d1znza_:

Click to download the PDB-style file with coordinates for d1znza_.
(The format of our PDB-style files is described here.)

Timeline for d1znza_: