Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Guanylate kinase [52542] (4 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [102339] (5 PDB entries) Rv1389 |
Domain d1znza1: 1znz A:20-201 [125415] automatically matched to d1s4qa_ complexed with gdp |
PDB Entry: 1znz (more details), 2.5 Å
SCOP Domain Sequences for d1znza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1znza1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl lv
Timeline for d1znza1: