| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
| Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
| Protein automated matches [226946] (29 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries) |
| Domain d1zm2a1: 1zm2 A:344-481 [125280] Other proteins in same PDB: d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5, d1zm2b_, d1zm2c2, d1zm2c3, d1zm2c4, d1zm2c5, d1zm2d_, d1zm2e2, d1zm2e3, d1zm2e4, d1zm2e5, d1zm2f_ automated match to d1n0ua1 complexed with apr |
PDB Entry: 1zm2 (more details), 3.07 Å
SCOPe Domain Sequences for d1zm2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm2a1 b.43.3.0 (A:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm
Timeline for d1zm2a1:
View in 3DDomains from same chain: (mouse over for more information) d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5 |