SCOPe 2.07: Domain d1z1va_: 1z1v A:

Lineage for d1z1va_ (1z1v A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)

6. Protein Ste50p, N-terminal domain [101244] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101245] (2 PDB entries)

8. Domain d1z1va_: 1z1v A: [124365]
   automated match to d1uqva_

Details for d1z1va_

PDB Entry: 1z1v

PDB Description: nmr structure of the saccharomyces cerevisiae ste50 sam domain

PDB Compounds: (A:) ste50 protein

SCOPe Domain Sequences for d1z1va_:

Sequence; same for both SEQRES and ATOM records:

>d1z1va_ a.60.1.2 (A:) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcdgdlnkaikf
kilinkmrds

Timeline for d1z1va_:

• d1z1va_ first appeared in SCOP 1.73, called d1z1va1
  
• d1z1va_ appears in SCOPe 2.06
  
• d1z1va_ appears in the current release, SCOPe 2.08