SCOP 1.73: Domain d1z1va1: 1z1v A:33-102

Lineage for d1z1va1 (1z1v A:33-102)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (2 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)

6. Protein Ste50p, N-terminal domain [101244] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101245] (2 PDB entries)

8. Domain d1z1va1: 1z1v A:33-102 [124365]
   automatically matched to d1uqva_

Details for d1z1va1

PDB Entry: 1z1v

PDB Description: nmr structure of the saccharomyces cerevisiae ste50 sam domain

PDB Compounds: (A:) ste50 protein

SCOP Domain Sequences for d1z1va1:

Sequence; same for both SEQRES and ATOM records:

>d1z1va1 a.60.1.2 (A:33-102) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcdgdlnkaikf
kilinkmrds

Timeline for d1z1va1:

• d1z1va1 is new in SCOP 1.73
  
• d1z1va1 appears in SCOP 1.75
  
• d1z1va1 appears in the current release, SCOPe 2.08, called d1z1va_