![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.149.1: RNase III domain-like [69065] (2 families) ![]() |
![]() | Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins) Pfam PF00636 |
![]() | Protein RNase III endonuclease catalytic domain [69067] (2 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries) |
![]() | Domain d1yykb1: 1yyk B:1-150 [124220] Other proteins in same PDB: d1yyka2, d1yykb2 automatically matched to d1rc7a1 protein/RNA complex; complexed with trs |
PDB Entry: 1yyk (more details), 2.5 Å
SCOPe Domain Sequences for d1yykb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yykb1 a.149.1.1 (B:1-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]} mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids grdanftrelfyklfkedilsaikegrvkk
Timeline for d1yykb1: