Lineage for d1yykb1 (1yyk B:1-150)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735030Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2735031Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2735032Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 2735036Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 2735037Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)
  8. 2735056Domain d1yykb1: 1yyk B:1-150 [124220]
    Other proteins in same PDB: d1yyka2, d1yykb2
    automated match to d1rc7a1
    protein/RNA complex; complexed with trs

Details for d1yykb1

PDB Entry: 1yyk (more details), 2.5 Å

PDB Description: Crystal structure of RNase III from Aquifex Aeolicus complexed with double-stranded RNA at 2.5-angstrom resolution
PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1yykb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yykb1 a.149.1.1 (B:1-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
grdanftrelfyklfkedilsaikegrvkk

SCOPe Domain Coordinates for d1yykb1:

Click to download the PDB-style file with coordinates for d1yykb1.
(The format of our PDB-style files is described here.)

Timeline for d1yykb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yykb2