Lineage for d1yo6f_ (1yo6 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841706Protein Carbonyl reductase sniffer [110413] (2 species)
  7. 2841709Species Nematode (Caenorhabditis elegans) [TaxId:6239] [186880] (1 PDB entry)
  8. 2841714Domain d1yo6f_: 1yo6 F: [123774]
    Other proteins in same PDB: d1yo6a1
    automated match to d1snya_

Details for d1yo6f_

PDB Entry: 1yo6 (more details), 2.6 Å

PDB Description: Crystal Structure of the putative Carbonyl Reductase Sniffer of Caenorhabditis elegans
PDB Compounds: (F:) Putative Carbonyl Reductase Sniffer

SCOPe Domain Sequences for d1yo6f_:

Sequence, based on SEQRES records: (download)

>d1yo6f_ c.2.1.2 (F:) Carbonyl reductase sniffer {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
spgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltvt
cdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvllt
qkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaainm
fgrtlavdlkddnvlvvnfcpgwvqtnlggknaaltveqstaelissfnkldnshngrff
mrnlkpyef

Sequence, based on observed residues (ATOM records): (download)

>d1yo6f_ c.2.1.2 (F:) Carbonyl reductase sniffer {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
spgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksdsrvhvlpltvtcd
ksldtfvskvgeivgsdsllinnagvllsygtntepnraviaeqldvnttsvvlltqkll
pllknaaskedqlsvsraavitissglgsitdntsgsaqfpvlayrmskaainmfgrtla
vdlkddnvlvvnfcpgwveqstaelissfnkldnshngrffmrnlkpyef

SCOPe Domain Coordinates for d1yo6f_:

Click to download the PDB-style file with coordinates for d1yo6f_.
(The format of our PDB-style files is described here.)

Timeline for d1yo6f_: