Lineage for d1ym7b1 (1ym7 B:29-185)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919295Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 919296Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 919297Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 919302Protein G-protein coupled receptor kinase 2, N-terminal domain [89090] (1 species)
  7. 919303Species Cow (Bos taurus) [TaxId:9913] [89091] (3 PDB entries)
  8. 919307Domain d1ym7b1: 1ym7 B:29-185 [123688]
    Other proteins in same PDB: d1ym7a2, d1ym7a3, d1ym7b2, d1ym7b3, d1ym7c2, d1ym7c3, d1ym7d2, d1ym7d3
    automatically matched to d1omwa1

Details for d1ym7b1

PDB Entry: 1ym7 (more details), 4.5 Å

PDB Description: g protein-coupled receptor kinase 2 (grk2)
PDB Compounds: (B:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d1ym7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ym7b1 a.91.1.1 (B:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee
ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp
yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d1ym7b1:

Click to download the PDB-style file with coordinates for d1ym7b1.
(The format of our PDB-style files is described here.)

Timeline for d1ym7b1: