Lineage for d1omwa1 (1omw A:29-185)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919295Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 919296Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 919297Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 919302Protein G-protein coupled receptor kinase 2, N-terminal domain [89090] (1 species)
  7. 919303Species Cow (Bos taurus) [TaxId:9913] [89091] (3 PDB entries)
  8. 919304Domain d1omwa1: 1omw A:29-185 [87086]
    Other proteins in same PDB: d1omwa2, d1omwa3, d1omwb_, d1omwg_

Details for d1omwa1

PDB Entry: 1omw (more details), 2.5 Å

PDB Description: crystal structure of the complex between g protein-coupled receptor kinase 2 and heterotrimeric g protein beta 1 and gamma 2 subunits
PDB Compounds: (A:) g-protein coupled receptor kinase 2

SCOPe Domain Sequences for d1omwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1omwa1 a.91.1.1 (A:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee
ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp
yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d1omwa1:

Click to download the PDB-style file with coordinates for d1omwa1.
(The format of our PDB-style files is described here.)

Timeline for d1omwa1: