Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Acetohydroxyacid synthase catalytic subunit [69463] (2 species) |
Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142123] (6 PDB entries) Uniprot P17597 281-459 |
Domain d1yi1a1: 1yi1 A:281-459 [123224] Other proteins in same PDB: d1yi1a2, d1yi1a3 automated match to d1ybha1 complexed with 1tb, fad, mg, nhe, p22 |
PDB Entry: 1yi1 (more details), 2.9 Å
SCOPe Domain Sequences for d1yi1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yi1a1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} pkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgipvastlmglgsypc ddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafasrakivhididsae igknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnvqkqkfplsfktfg
Timeline for d1yi1a1: