SCOPe 2.01: Domain d1ycia_: 1yci A:

Lineage for d1ycia_ (1yci A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (2 proteins)

6. Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82196] (11 PDB entries)

8. Domain d1ycia_: 1yci A: [122965]
   automated match to d1iz3a_
   complexed with fe2, ndf, so4

Details for d1ycia_

PDB Entry: 1yci, 2.7 Å

PDB Description: Factor inhibiting HIF-1 alpha in complex with N-(carboxycarbonyl)-D-phenylalanine

PDB Compounds: (A:) hypoxia-inducible factor 1 alpha inhibitor

SCOPe Domain Sequences for d1ycia_:

Sequence; same for both SEQRES and ATOM records:

>d1ycia_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
gepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypa
lkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklq
diqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmeg
nvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfp
nfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkah
qkvaimrniekmlgealgnpqevgpllntmikgryn

Timeline for d1ycia_:

• d1ycia_ first appeared in SCOP 1.73, called d1ycia1
  
• d1ycia_ was called d1ycia1 in SCOP 1.75
  
• d1ycia_ appears in SCOPe 2.02
  
• d1ycia_ appears in the current release, SCOPe 2.08