Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (2 proteins) |
Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82196] (11 PDB entries) |
Domain d1ycia_: 1yci A: [122965] automated match to d1iz3a_ complexed with fe2, ndf, so4 |
PDB Entry: 1yci (more details), 2.7 Å
SCOPe Domain Sequences for d1ycia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycia_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} gepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypa lkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklq diqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmeg nvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfp nfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkah qkvaimrniekmlgealgnpqevgpllntmikgryn
Timeline for d1ycia_: