Lineage for d1iz3a_ (1iz3 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963404Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 963548Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (2 proteins)
  6. 963549Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)
  7. 963550Species Human (Homo sapiens) [TaxId:9606] [82196] (11 PDB entries)
  8. 963560Domain d1iz3a_: 1iz3 A: [83831]
    complexed with so4

Details for d1iz3a_

PDB Entry: 1iz3 (more details), 2.8 Å

PDB Description: Dimeric structure of FIH (Factor inhibiting HIF)
PDB Compounds: (A:) fih

SCOPe Domain Sequences for d1iz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz3a_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
gsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvy
palkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefvek
lqdiqqrggeerlylqqtlndtvggkivmdflgfnwnwinkqqgkrgwgqltsnllligm
egnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyer
fpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplk
ahqkvaimrniekmlgealgnpqevgpllntmikgryn

SCOPe Domain Coordinates for d1iz3a_:

Click to download the PDB-style file with coordinates for d1iz3a_.
(The format of our PDB-style files is described here.)

Timeline for d1iz3a_: