Lineage for d1xfxp1 (1xfx P:3-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710701Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries)
    Uniprot P02593
  8. 2710868Domain d1xfxp1: 1xfx P:3-75 [121956]
    automatically matched to d1ak8__
    complexed with ca, mg

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1xfxp1

PDB Entry: 1xfx (more details), 3.2 Å

PDB Description: crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 10 millimolar exogenously added calcium chloride
PDB Compounds: (P:) Calmodulin 2

SCOPe Domain Sequences for d1xfxp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfxp1 a.39.1.5 (P:3-75) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmark

SCOPe Domain Coordinates for d1xfxp1:

Click to download the PDB-style file with coordinates for d1xfxp1.
(The format of our PDB-style files is described here.)

Timeline for d1xfxp1: