SCOPe 2.07: Domain d1xcrb_: 1xcr B:

Lineage for d1xcrb_ (1xcr B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
   duplication: consists of two similar beta-alpha-beta(4) motifs

4. Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families)
   characteristic metal ion (zinc)-binding motif in the putative active site

5. Family d.290.1.2: PTD012-like [143091] (1 protein)
   automatically mapped to Pfam PF08925

6. Protein Hypothetical protein PTD012 [143092] (1 species)
   Ester hydrolase C11orf54

7. Species Human (Homo sapiens) [TaxId:9606] [143093] (1 PDB entry)
   Uniprot Q9H0W9 3-315

8. Domain d1xcrb_: 1xcr B: [121861]
   automated match to d1xcra1
   complexed with acy, zn

Details for d1xcrb_

PDB Entry: 1xcr, 1.7 Å

PDB Description: Crystal Structure of Longer Splice Variant of PTD012 from Homo sapiens reveals a novel Zinc-containing fold

PDB Compounds: (B:) hypothetical protein PTD012

SCOPe Domain Sequences for d1xcrb_:

Sequence; same for both SEQRES and ATOM records:

>d1xcrb_ d.290.1.2 (B:) Hypothetical protein PTD012 {Human (Homo sapiens) [TaxId: 9606]}
caefsfhvpsleelagvmqkglkdnfadvqvsvvdcpdltkepftfpvkgicgktriaev
ggvpyllplvnqkkvydlnkiakeiklpgafilgagagpfqtlgfnsefmpviqtesehk
ppvngsyfahvnpadggcllekysekchdfqcallanlfasegqpgkvievkakrrtgpl
nfvtcmretlekhygnkpigmggtfiiqkgkvkshimpaefsscplnsdeevnkwlhfye
mkaplvclpvfvsrdpgfdlrlehthffsrhgegghyhydttpdiveylgyflpaeflyr
idqpkethsigrd

Timeline for d1xcrb_:

• d1xcrb_ first appeared in SCOP 1.73, called d1xcrb1
  
• d1xcrb_ appears in SCOPe 2.06
  
• d1xcrb_ appears in the current release, SCOPe 2.08