Lineage for d1xcra1 (1xcr A:3-315)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615725Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
    duplication: consists of two similar beta-alpha-beta(4) motifs
  4. 2615726Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) (S)
    characteristic metal ion (zinc)-binding motif in the putative active site
  5. 2615734Family d.290.1.2: PTD012-like [143091] (1 protein)
    automatically mapped to Pfam PF08925
  6. 2615735Protein Hypothetical protein PTD012 [143092] (1 species)
    Ester hydrolase C11orf54
  7. 2615736Species Human (Homo sapiens) [TaxId:9606] [143093] (1 PDB entry)
    Uniprot Q9H0W9 3-315
  8. 2615737Domain d1xcra1: 1xcr A:3-315 [121860]
    complexed with acy, zn

Details for d1xcra1

PDB Entry: 1xcr (more details), 1.7 Å

PDB Description: Crystal Structure of Longer Splice Variant of PTD012 from Homo sapiens reveals a novel Zinc-containing fold
PDB Compounds: (A:) hypothetical protein PTD012

SCOPe Domain Sequences for d1xcra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcra1 d.290.1.2 (A:3-315) Hypothetical protein PTD012 {Human (Homo sapiens) [TaxId: 9606]}
caefsfhvpsleelagvmqkglkdnfadvqvsvvdcpdltkepftfpvkgicgktriaev
ggvpyllplvnqkkvydlnkiakeiklpgafilgagagpfqtlgfnsefmpviqtesehk
ppvngsyfahvnpadggcllekysekchdfqcallanlfasegqpgkvievkakrrtgpl
nfvtcmretlekhygnkpigmggtfiiqkgkvkshimpaefsscplnsdeevnkwlhfye
mkaplvclpvfvsrdpgfdlrlehthffsrhgegghyhydttpdiveylgyflpaeflyr
idqpkethsigrd

SCOPe Domain Coordinates for d1xcra1:

Click to download the PDB-style file with coordinates for d1xcra1.
(The format of our PDB-style files is described here.)

Timeline for d1xcra1: