Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily) duplication: consists of two similar beta-alpha-beta(4) motifs |
Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) characteristic metal ion (zinc)-binding motif in the putative active site |
Family d.290.1.2: PTD012-like [143091] (1 protein) automatically mapped to Pfam PF08925 |
Protein Hypothetical protein PTD012 [143092] (1 species) Ester hydrolase C11orf54 |
Species Human (Homo sapiens) [TaxId:9606] [143093] (1 PDB entry) Uniprot Q9H0W9 3-315 |
Domain d1xcra1: 1xcr A:3-315 [121860] complexed with acy, zn |
PDB Entry: 1xcr (more details), 1.7 Å
SCOPe Domain Sequences for d1xcra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xcra1 d.290.1.2 (A:3-315) Hypothetical protein PTD012 {Human (Homo sapiens) [TaxId: 9606]} caefsfhvpsleelagvmqkglkdnfadvqvsvvdcpdltkepftfpvkgicgktriaev ggvpyllplvnqkkvydlnkiakeiklpgafilgagagpfqtlgfnsefmpviqtesehk ppvngsyfahvnpadggcllekysekchdfqcallanlfasegqpgkvievkakrrtgpl nfvtcmretlekhygnkpigmggtfiiqkgkvkshimpaefsscplnsdeevnkwlhfye mkaplvclpvfvsrdpgfdlrlehthffsrhgegghyhydttpdiveylgyflpaeflyr idqpkethsigrd
Timeline for d1xcra1: