SCOPe 2.08: Domain d1x18g1: 1x18 G:11-129

Lineage for d1x18g1 (1x18 G:11-129)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (2 species)

7. Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
   Uniprot P80376

8. Domain d1x18g1: 1x18 G:11-129 [121575]
   Other proteins in same PDB: d1x18e1, d1x18f1, d1x18h1, d1x18x1, d1x18x2
   automatically matched to d1i94k_
   protein/RNA complex

Details for d1x18g1

PDB Entry: 1x18

PDB Description: contact sites of era gtpase on the thermus thermophilus 30s subunit

PDB Compounds: (G:) 30S ribosomal protein S11

SCOPe Domain Sequences for d1x18g1:

Sequence; same for both SEQRES and ATOM records:

>d1x18g1 c.55.4.1 (G:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

Timeline for d1x18g1:

• d1x18g1 first appeared in SCOP 1.73
  
• d1x18g1 appears in SCOPe 2.07